1. The number of mole of C₃H₈ needed to make 15.5 moles of CO₂ is 5.2 moles
2. The number of moles of O₂ needed is 25.8 moles
1. How do I determine the number of mole of C₃H₈ needed?The number of mole of C₃H₈ needed can be obtained as illustrasted below:
C₃H₈ + 5O₂ -> 3CO₂ + 4H₂O
From the balanced equation above,
3 moles of CO₂ was obtained from 1 mole of C₃H₈
Therefore,
15.5 moles of CO₂ will be obtain from = (15.5 × 1) / 3 = 5.2 moles of C₃H₈
Thus, number of mole of C₃H₈ needed is 5.2 moles
2. How do I determine the number of mole of O₂ needed?We can obtain the number of mole of O₂ needed as follow:
C₃H₈ + 5O₂ -> 3CO₂ + 4H₂O
From the balanced equation above,
3 moles of CO₂ was obtained from 5 moles of O₂
Therefore,
15.5 moles of CO₂ will be obtain from = (15.5 × 5) / 3 = 25.8 moles of O₂
Thus, number of mole of O₂ needed is 25.8 moles
Learn more about number of mole:
https://brainly.com/question/23350512
#SPJ1
Complete question:
How many moles of C₃H₈ are needed to make
15.5 moles of CO₂? How much O₂ will be needed?
C₃H₈ + 5O₂ -> 3CO₂ + 4H₂O
Ribosomes are packets of RNA and protein that play a crucial role in both animal and plant cells. Ribosomes aid in the process of
Answer: mutation
Explanation:
A venus fly trap snaps shut when a fly lands on the trigger hairs inside its trap.
Which characteristic of life does this represent?
reproduction
A. cell organization
B. heredity
C. response to environment
Answer:
C. Response to environment
Are sperm and egg cells exact copies of the plant cell
Answer:
No
Explanation:
thats scientifically impossible
Chuck wants to know how many electrons in an atom are not paired up. Which model would be best for Chuck to write out?
- a set of quantum numbers for the last electron in the atom
- a configuration with numbers, letters, and superscripts
- a dot structure of the atom
- an orbital notation of the atom
Answer: an orbital notation of the atom
Explanation:
If Chuck wants to know how many electrons in an atom are not paired up, the model that would be best for Chuck to write out is an orbital notation of the atom.
Orbital notation is simply utilized to write the configuration of an electron so that certain information regarding the electrons that are contained in the atom of an element can be known. It should also be noted that the orbital notation can help in knowing an electron's quantum numbers.
Therefore, the answer is "an orbital notation of the atom".
Answer:
an orbital notation of the atom
Explanation:
b) Ammonia and sulfuric acid react according to the equation given below. How many millilitres of 0.110 M sulfuric acid are required to neutralize exactly 25.0 mL of 0.0840 M NH3 solution? 2 NH3(aq) + H₂SO4 (aq) → (NH4)2SO4(aq)
The amount of 0.110 M sulfuric acid are required to neutralize exactly 25.0 mL of 0.0840 M NH3 solution is 9.55mL.
A Neutralization Reaction: What Is It?A neutralisation reaction is a chemical process in which an acid and a base combine to produce salt and water as the end products. H+ ions and OH- ions combine to generate water during a neutralisation process.
2 NH3(aq) + H₂SO4 (aq) → (NH4)2SO4(aq)
moles of NH3 = (25ml x 1L/1000mL) x 0.084M
=> 2.1x 10^(-3) moles
The mole ratio of NH3 to H₂SO4 in the given reaction
=> moles of H₂SO4 = 2.1 x 10^(-3) moles of NH3 x 1 molesH₂SO4/2 moles
NH3
=> 1.05 x 10^(-3) moles
Volume = moles/molarity
=> 1.05 10^(-3) moles/0.110M
=> 9.55 x 10^(-3) L = 9.55mL
Learn more about neutralization reaction here:
brainly.com/question/28970253
#SPJ1
Which of the following statements describes the cause of ice ages
What causes the changes in the ice ages is when the earth's orbits tilts.
What is the cause of the ice ages?
The ice ages are caused by changes in Earth's orbit and tilt, which affect the amount of solar radiation received by the planet. These changes alter the climate and trigger the growth and retreat of ice sheets.
We know that the changes in the climates is responsible for most of the changes that we can see in the universe as we have come to experience it today.
Thus the earth's orbits is what does control the changes in the ice ages.
Learn more about the ice ages:https://brainly.com/question/29417575
#SPJ1
URGENT!! WILL MARK ANYONE WITH ALL ANSWERS AS BRAINLIEST!!!
Answer:
1) 9 moles
2) 8.75 moles
3) 1.76 moles
4) 10.2 moles
Explanation:
Okay so mole ratio is 2:1
So, 9 moles of HI is required for 4.5 moles of Iodine gas
Mol ratio of water to CaCl2 is 2:1
So, 17.5 moles of water produced is (17.5/2) moles of CaCl2 i.e. 8.75 moles
Okay so mol ratio of Hydrogen to NH3 is 3:2
So, 2.64 moles of hydrogen is (2.64 * 2)/3 moles of NH3 i.e. 1.76 moles
Once again, mol ratio of Hydrogen to NH3 is 3:2
When 15.3 moles of hydrogen is used, (15.3 * 2)/3 moles of NH3 i.e. 10.2 moles
Hope this helps and be sure to mark this as brainliest! :)
BALANCE:
__ Fe2O3 ---> __FeO + O2
after balancing find:
how many moles of FeO are produced from 8 moles of Fe2O3
SHOW WORK
According to the balanced equation 4Fe2O3 -> 6FeO + O2, we find that 4 moles of Fe2O3 produce 6 moles of FeO. Using this ratio, we can calculate that 8 moles of Fe2O3 will produce 12 moles of FeO.
To balance the equation:
Fe2O3 -> FeO + O2
We need to ensure that the number of atoms of each element is equal on both sides of the equation. Here's the balanced equation:
4Fe2O3 -> 6FeO + O2
From the balanced equation, we can see that 4 moles of Fe2O3 produce 6 moles of FeO.
To find how many moles of FeO are produced from 8 moles of Fe2O3, we can set up a proportion:
4 moles Fe2O3 / 6 moles FeO = 8 moles Fe2O3 / x moles FeO
Cross-multiplying and solving for x:
4 * x = 6 * 8
x = (6 * 8) / 4
x = 12
Therefore, 8 moles of Fe2O3 will produce 12 moles of FeO.
For more such question on equation. visit :
https://brainly.com/question/26694427
#SPJ8
An electron has a
charge.
An electron has a negative charge.
The charge of an electron is a fundamental property of the particle, and it is denoted by the symbol "e." The magnitude of the charge of an electron is approximately 1.602 × 10^-19 coulombs (C). This value is considered the elementary charge and is used as a reference for other charges. The charge of an electron plays a significant role in determining the behavior and interactions of atoms and molecules. It is opposite in sign to the charge of a proton, which is positive. The electron's charge allows it to interact with other charged particles, such as protons and ions, through electrostatic forces. Electrons are subatomic particles that orbit the nucleus of an atom in specific energy levels or orbitals. They contribute to the overall stability and chemical properties of atoms and participate in chemical bonding and reactions. The movement of electrons between atoms is what enables the formation of chemical bonds and the sharing or transfer of electrons to create ions. In summary, the charge of an electron is negative, and it plays a fundamental role in the structure and behavior of atoms and molecules.
for more questions on electron
https://brainly.com/question/26084288
#SPJ8
An argon ion laser emits visible radiation with photons of energy 4.071 x 10-19 J. What is the
wavelength of the radiation?
The wavelength of the radiation emitted by the argon ion laser is \(4.854 * 10^-7 m\).
Wavelength is a property of any type of wave that refers to the distance between two adjacent points on the wave that is in phase, i.e., at the same point in their respective cycles. It is usually denoted by the Greek letter lambda (λ) and is measured in units of length, such as meters or nanometers.
The energy carried by the photon (E) is related to the wavelength (\(\lambda\)) through the following equation:
\(E=hc/\lambda\); where 'h' is the Plank's Constant and 'c' is the speed of light which is \(3* 10^{-7} m/s\).
We can say that
\(\lambda - hc/E\)
Now after substituting the given values, we get:
\(\lambda = (6.626 * 10^{-34} J.s * 3.00 * 10^8 m/s) / (4.071 * 10^{-19} J)\\\lambda = 4.854 * 10^-7 m\)
Therefore the wavelength of the radiation emitted by the argon ion laser is \(4.854 * 10^-7 m\).
Learn more about the Plank's Constant at:
https://brainly.com/question/28060145
#SPJ4
Which process occurs when one nucleus splits to form 2 smaller nuclei?
fission
fusion
radioactive decay
Answer: fission
Explanation:
Want some points??
Answer:
yea i do
Explanation:
LETSSS GOOOOOO
What functional group results when cyclopentanone reacts with ethylamine in the presence of trace acid? A) cyanohydrin B) semicarbazone C) imine D) enamine E) oxime
Stephan’s mother cuts a twig from a rose bush and plants it in the soil. After a few days, Stephan observes a new plant growing. Which characteristic does the growth of the new plant depict?
The growth of the new plant depicts the asexual reproduction characteristic. The characteristic that describes the growth of the new plant in Stephan's mother cutting a twig from a rose bush and planting it in the soil is asexual reproduction.
Asexual reproduction is the mode of reproduction by which organisms generate offspring that are identical to the parent's without the fusion of gametes. Asexual reproduction is a type of reproduction in which the offspring is produced from a single parent.
The offspring created are clones of the parent plant, meaning they are identical to the parent.The new plant in Stephan’s mother cutting a twig from a rose bush and planting it in the soil depicts the process of asexual reproduction, which is the ability of a plant to reproduce without seeds. In asexual reproduction, plants can reproduce vegetatively by cloning themselves using their roots, bulbs, or stems.
Know more about characteristic here:
https://brainly.com/question/28790299
#SPJ8
A student dissolves 7.9 g of stilbene (C14H12) in 475. mL of a solvent with a density of 1.03 g/mL. The student notices that the volume of the solvent does not change when the stilbene dissolves in it. Calculate the molarity and morality of the students solution. Round both of your answers to 2 significant digits.
Answer:
Molarity: 0.092M
Molality: 0.090m
Explanation:
Molarity, M, is defined as the moles of solute (In this case, C14H12 -Molar mass: 180.25g/mol-) in 1L of solution.
The molality, m, are moles of solute per kg of solvent.
Molarity:
Moles solute:
7.9g * (1mol/180.25g) = 0.04383 moles
Liters solution:
475mL = 0.475L
Molarity: 0.04383 moles / 0.475L = 0.092M
Molality:
kg solvent:
475mL * (1.03g/mL) = 489.25g = 0.48925kg
Molality:
0.04383 moles / 0.48925kg = 0.090m
How do atoms form chemical bonds
Answer:
Atoms form chemical bonds to achieve a full outer energy level, which is the most stable arrangement of electrons. A chemical bond is a force of attraction between atoms or ions. Bonds form when atoms share or transfer valence electrons. In a covalent bond, two atoms share one or more electrons.
What is the molarity of a solution that has 450 grams of sodium chloride in 800.0 mL of
water?
Answer:
= 9.6125M
Explanation:
data:
volume = 800ml
800/ 1000 = 0.8dm^3
molar mass of NaCl = 23 + 35.5
= 58.5g
mass of NaCl = 450 g
moles= ?
molarity = ?
solution:
no. of moles = \(\frac{given mass}{molar mass}\)
= 450 / 58.5
= 7.69 moles
now, molarity = \(\frac{moles}{volume in dm^3}\)
= 7.69 / 0.8
molarity= 9.6125 M
the first 32 amino acids from the N terminus of the protein bovine angiogenin were determined by edman degradation and have the sequence: AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK (a) Identify the sites of cleavage during trypsin-catalyzed hydrolysis of this protein. (b) What are the cleavage sites using chymotrypsin?
The first 32 amino acids from the N terminus of the protein bovine angiogenin were determined by edman degradation. (a) The cleavage sites for the trypsin-catalyzed hydrolysis are, AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMK.
(b) The following cleavage sites take place during hydrolysis that is catalyzed by chymotrypsin: AQDDYRYIHFLTQHYCFNMMK. Site-selective breakdown of extremely non-reactive peptide bonds also functions as a therapeutically helpful modulator of protein structure and function, providing essential information on the protein sequence. Regulated and selective cleavage is a challenging task and requires chemical reagents to be able to recognize or bind to one or more specific amino acid residues in the peptide chain. On the basis of this concept, we developed a technique that selectively changes the serine residue in a peptide chain using a chemical reagent, causing the peptide backbone to break at the N-terminus of the serine residue. After cleavage, modified residues can be transformed back into their original form. This method may cleave a wide variety of substrates and does so specifically for certain bioactive peptides with post-translational modifications (like N-acetylation and -methylation) and mutations (like D- and -amino acids), which are known to contribute to age-related diseases.
To know more about cleavage please refer: https://brainly.com/question/9161095
#SPJ4
An atom has 6 protons, 7 neutrons and 5 electrons. what element is it?
Answer:
Carbon
Explanation:
Because it was very
A piece of aluminum weighs 0.475g and measures 10.08cm by10.08cm. Calculate the thickness of the aluminum
The thickness of the aluminum is approximately 0.00172 cm or 0.0172 mm
To calculate the thickness of the aluminum, we need to use the formula:
Density = Mass / (Length x Width x Thickness)
Given:
Mass of aluminum = 0.475 g
Length of aluminum = 10.08 cm
Width of aluminum = 10.08 cm
We need to rearrange the formula to solve for thickness:
Thickness = Mass / (Length x Width x Density)
The density of aluminum is approximately 2.7 g/cm³.
Now we can substitute the given values into the formula:
Thickness = 0.475 g / (10.08 cm x 10.08 cm x 2.7 g/cm³)
Thickness ≈ 0.475 g / (102.4064 cm² x 2.7 g/cm³)
Thickness ≈ 0.475 g / 275.879104 cm³
Thickness ≈ 0.00172 cm or 0.0172 mm
Therefore, the thickness of the aluminum is approximately 0.00172 cm or 0.0172 mm.
for more such questions on aluminum
https://brainly.com/question/21966290
#SPJ8
What is the atomic mass of an atom with 17 protons, 17 electrons, and 18 neutrons?
Answer:
Mass number 35
Explanation:
17+ 18 =35.
What ideas do you have about why Christchurch’s air temperature is cooler during el niño years?
One possible reason for cooler air temperatures in Christchurch during El Niño years is the shift in atmospheric circulation patterns.
During El Niño years, Christchurch may experience cooler air temperatures due to several factors associated with the El Niño phenomenon.
El Niño is characterized by the abnormal warming of the surface waters in the eastern tropical Pacific Ocean, which has global climatic implications. While El Niño is primarily associated with changes in oceanic conditions, its effects can extend to atmospheric patterns, leading to altered weather patterns and temperature variations.
One possible reason for cooler air temperatures in Christchurch during El Niño years is the shift in atmospheric circulation patterns. El Niño can disrupt the normal global atmospheric circulation, resulting in changes in the positioning and intensity of weather systems.
This can lead to the advection of cooler air masses from the south or southeast towards Christchurch, resulting in cooler temperatures.
Another factor is the influence of El Niño on regional rainfall patterns. El Niño often leads to drier conditions in the South Island of New Zealand, including Christchurch.
Reduced cloud cover and less moisture in the air can contribute to cooler temperatures as there is less insulation from the sun's radiation and less evaporative cooling. Additionally, the absence of significant rainfall can result in less moisture in the soil, leading to cooler conditions as less energy is used for evaporation.
For more such questions on temperatures visit:
https://brainly.com/question/4735135
#SPJ8
Liquid octane (CH3(CH2)6CH3) will react with gaseous oxygen (O2) to produce gaseous carbon dioxide (CO2) and gaseous water (H2O). Suppose 17. g of octane is mixed with 112. g of oxygen. Calculate the maximum mass of water that could be produced by the chemical reaction. Round your answer to significant digits.
The maximum mass of water that could be produced by the chemical reaction is 162 g.
The given chemical equation is: 2 C8H18(l) + 25 O2(g) → 16 CO2(g) + 18 H2O(l)In the chemical reaction of liquid octane with gaseous oxygen, the products are gaseous carbon dioxide and gaseous water.According to the balanced chemical equation, 2 moles of C8H18 react with 25 moles of O2 to form 18 moles of H2O.So, 1 mole of C8H18 react with 25/2 = 12.5 moles of O2 to form 9 moles of H2O.The molar mass of C8H18 is 114 g/mol. So, the number of moles in 17 g of C8H18 is:17 g / 114 g/mol = 0.149 molThe molar mass of O2 is 32 g/mol. So, the number of moles in 112 g of O2 is:112 g / 32 g/mol = 3.5 molFrom the balanced chemical equation, 1 mole of C8H18 react with 12.5 moles of O2 to form 9 moles of H2O.So, the number of moles of O2 required to react with 0.149 mol of C8H18 to form H2O is:(12.5 mol / 1 mol) × (0.149 mol / 2 mol) = 0.935 molThe maximum number of moles of H2O that can be produced from 0.149 mol of C8H18 and 0.935 mol of O2 is 9 mol.So, the mass of water produced from 17 g of C8H18 and 112 g of O2 is:9 mol × 18 g/mol = 162 g
for more questions on chemical reaction
https://brainly.com/question/25769000
#SPJ8
how many moles of F are in 708.5g of F4C?
The number of mole of F present in 708.5 grams of F₄C is 32.2 moles
How do i determine the number of mole of F present 08.5 grams of F₄C?First, we shall determine the mole in 708.5 grams of F₄C. Details below:
Mass of F₄C = 708.5 grams Molar mass of F₄C = 88 g/mol Mole of F₄C =?Mole = mass / molar mass
Mole of F₄C = 708.5 / 88
Mole of F₄C = 8.05 moles
Finally, we shall determine the number of mole of F in 708.5 grams (i.e 8.05 moles) of F₄C. Details below:
From the chemical formula of F₄C,
1 mole of F₄C contains 4 moles of F.
Therefore,
8.05 moles of F₄C will contain = (8.05 mole × 4 mole) / 1 mole = 32.2 moles of F.
Thus, we can conclude from the above calculation that the number of mole of F present is 32.2 moles
Learn more about mole composition:
https://brainly.com/question/21323029
#SPJ1
Which substance contains particles with the highest average kinetic energy?
A. 1 kilogram of ice
B. 1 liter of water
C. 1 liter of water vapor
D. 1 kilogram of snow
Answer: C. 1 liter of water vapor
Explanation:
The average kinetic energy increases as follows.
Gas > Liquid > Solid
You can think about it as how fast and freely the molecules are moving in each state, with gases being the greatest.
what are thetypes of luminous flame
Types of luminous flames:
1. Yellow Luminous Flame
2. Smoky Luminous Flame
3. Orange Luminous Flame
4. Blue Luminous Flame
Luminous flames are characterized by their visible glow, which is caused by the incomplete combustion of fuel. The presence of soot particles in the flame causes the emission of light. There are different types of luminous flames, which can be classified based on their fuel composition and burning conditions. Here are some common types of luminous flames:
1. Yellow Luminous Flame: This is the most common type of luminous flame, often seen in open fires, candles, and gas stoves. It appears yellow due to the presence of soot particles in the flame. Yellow flames indicate incomplete combustion of hydrocarbon fuels, such as methane, propane, or natural gas. The high carbon content in these fuels leads to the formation of soot, which emits visible light.
2. Smoky Luminous Flame: This type of flame is characterized by a significant amount of black smoke and soot production. It is commonly observed in poorly adjusted or malfunctioning burners or engines. The excessive presence of unburned fuel in the flame results in incomplete combustion and the emission of dark smoke particles.
3. Orange Luminous Flame: An orange flame indicates a higher combustion temperature compared to a yellow flame. It is often seen in more efficient burners or when burning fuels with a higher carbon content, such as oil or diesel. The higher temperature helps in burning more of the carbon particles, reducing the amount of soot and making the flame appear less yellow.
4. Blue Luminous Flame: A blue flame is typically associated with complete combustion. It indicates efficient burning of fuel, resulting in minimal soot formation. Blue flames are commonly observed in gas burners or Bunsen burners. The blue color is a result of the combustion of gases, such as methane, in the presence of sufficient oxygen.
It's important to note that the luminosity of a flame can vary depending on factors such as fuel-air mixture, combustion temperature, and the presence of impurities. Achieving complete combustion and minimizing the production of soot is desirable for efficient and cleaner burning processes.
for more questions on luminous
https://brainly.com/question/27163038
#SPJ8
Part 2 The student wanted to know if the value obtained from their experiment (part 1) is similar to that calculated using average bond enthalpy data.
a) Using the balanced equation and the data in the table below, calculate the theoretical enthalpy of combustion.
Note: you will need to include the enthalpy of vaporisation for the liquid components which are also given.
C₂H5OH()+302(g) → 2CO2(g) + 3H₂O(1)
Average Bond Enthalpies (kJ mol-¹)
C-H 412
C-C 348
C-O 358
O=O 496
C=O 743
O-H 463
Enthalpy of Vaporisation (kJ mol-¹)
Ethanol 42.5
Water 41
-1113.5kJ is the theoretical enthalpy of combustion.
What makes energy different from enthalpy?
The entire amount of heat energy that is either absorbed or released in a thermodynamic system is measured by enthalpy. Internal energy denotes all of the potential or moving energy present in a thermodynamic system.
Enthalpy of combustion is the term used to describe the change in a system's enthalpy that occurs when one mole of a substance fully burns in oxygen or air at a specific temperature.
C₂H5OH()+302(g) → 2CO2(g) + 3H₂O(1)
Reactants:
5 C-H : 5*412
1 C-C : 348
1 C-O: 358
3 O=O: 3* 496
1 O-H: 463
Products:
2*2 C=O : 4*743
2*3 O-H: 6*463
Enthalpy of Vaporization (kJ mol-¹) for :
Ethanol 42.5
Water 41
Enthalpy of combustion : (5*412 + 348 + 358 + 3* 496 + 463 + 42.5) - ( 3*41 + 4*743 + 6*463)
: -1113.5kJ
To learn more about enthalpy use :
https://brainly.com/question/5374936
#SPJ1
why was the use of ethephon banned by the FDCA
Explanation:
Toxicity
Ethephon is corrosive in acute dermal irritation studies using rabbits,
has the potential to cause eye irritation, and has been placed in Toxicity
Category I (the highest of four categories) for these effects. It is moderately
acutely toxic by the oral, dermal and inhalation routes (Toxicity Category
III), and does not cause skin sensitization.
An organophosphate pesticide, ethephon caused plasma cholinesterase
inhibition in a 16-day oral human study and clinical signs of toxicity in a
second study. In a dermal toxicity study using rabbits, skin effects were
observed at all doses.
In a combined chronic/oncogenicity study using rats, plasma and
erythrocyte cholinesterase were inhibited at all doses. At the highest dose
levels, ethephon caused body weight decrease and kidney effects, but no
carcinogenic effects were observed. In a cancer study using mice, no
evidence of treatment related tumors was observed. Ethephon has been
classified as a Group D carcinogen based on "the insufficiency of the weight
of evidence" regarding its cancer-causing potential.
One chronic toxicity study using beagle dogs caused plasma
cholinesterase inhibition at all doses, and smooth muscle atrophy in the gut.
In a second beagle dog study, treatment related effects included decreased
spleen and body weight plus decreased hemoglobin and hematocrit in the
males.
Developmental toxicity studies using rats and rabbits show no
evidence of a potential for developmental effects at doses that are not toxic
to the mother. In a reproductive toxicity study using rats, administration of
the test compound caused decreased survival in the offspring and decreased
body weight gain in adult females, but no effects on fertility, gestation,
mating, organ weights, or histopathology in any generation.
Ethephon was positive in one mutagenicity study and negative in two
others. It does not appear to cause delayed neurotoxicity based on a study
using hens, however studies using mammals are now required as
confirmatory data.
Human poisoning incidents involving ethephon include four cases of
skin injury (irritation) in California as a result of exposure to field residues,
one possible systemic poisoning case, and 29 telephone calls to the National
Pesticides Telecommunications Network reporting eye and skin irritation
from misuse of ethephon, sometimes in combination with other pesticides.
Dietary Exposure
People may be exposed to residues of ethephon through the diet.
Tolerances or maximum residue limits have been established for ethephon in
many raw agricultural commodities, processed foods, and feed. Please see
40 CFR 180.300(a) and (b), 185.2700(a), (b) and (c), and 186.2700(a).
When all the soil pores are essentially water-filled, flow is termed _______________ .
Unsaturated
Saturated
Gravitional
Rapid
which of these is a cost of using paper grocery bags
Answer:
15 cents where im from
Explanation: