The statement 'a norm is a set of expected behaviors for a particular position' is False.
What is a norm?A norm is a specific value and/or ideal adopted by society as true and established in its culture and costumes.
Norms are fundamental for the healthy functioning of a society and allows to establish parameters of development.
The true statement here is 'a ROLE is a set of expected behaviors for a particular position'.
In conclusion, the statement 'a norm is a set of expected behaviors for a particular position' is False.
Learn more about norms and roles here:
https://brainly.com/question/16950965
#SPJ1
The measure of how a student’s performance compares with that of other students in his or her class is called
what do you mean by physical quality
Physical quality refers to a tangible object or entity's characteristics, attributes, or properties that determine its level of excellence, durability, reliability, or overall performance.
It refers to the objective measures of how well a product or service meets the established standards or specifications.
Physical quality is typically evaluated based on factors such as appearance, functionality, structural integrity, strength, precision, consistency, and other physical attributes.
For example, in manufacturing, physical quality may involve assessing the dimensional accuracy, material properties, surface finish, and overall workmanship of a product. In the context of services, physical quality may refer to the condition and maintenance of physical facilities, equipment, or infrastructure.
Maintaining high physical quality is important for customer satisfaction, as it directly affects the usability, reliability, and longevity of a product or service. By meeting or exceeding customer expectations in terms of physical quality, businesses can enhance their reputation, build customer loyalty, and gain a competitive advantage in the marketplace.
For more questions on Physical quality
https://brainly.com/question/19296380
#SPJ8
why did the mushroom go to the party
uh I don't know why? tell me im really clueless
The houses in the "historic district" of a particular town are either historically protected or not.
The above table partially represents these homes and whether they have foundations made from
poured concrete, mortar and field stone, or a combination of both. If only 4.5% of the non-
historically-protected homes have a field stone and mortar foundation, how many homes is this?
Round to the nearest whole number.
Answer:
6
Explanation:
339-205= 134
134*0.045= 6.03= 6
An area of a city that has older structures deemed noteworthy for historical or architectural reasons is called a historic district or heritage district.
What is Historic District?Historic districts are legally protected from particular sorts of development in some nations or jurisdictions.
The heart of the city may or may not be in historic districts. These could be distinct from the business district, the administrative district, or the arts district.
Historical districts are frequently a component of a larger metropolitan environment, but they can also be all or a portion of small towns, rural areas with historic agricultural-related properties, or even a geographically detached collection of related buildings spread out across the region.
Therefore, An area of a city that has older structures deemed noteworthy for historical or architectural reasons is called a historic district or heritage district.
To learn more about historic disctrict, refer to the link:
https://brainly.com/question/22835270
#SPJ2
Solve for
A
B
C
D
Hurry please!!! I’ll give the brainliest answer to whoever shows their works first!!!!
PLEASE HELP ASAP!!!
Answer:
Explanation:
Im only in 9th grade aint
no 11 grader LOL R.I.P YOU
Is 1180 a good sat score to get into a college of my choice if I have a 4.3+ GPA?
Colleges like University of Tennessee or University of Missouri or Texas A&M University or University of Texas or University of Colorado normal colleges like that.
Could I get in easily or do I need to retake the SAT or is there something else I could do to improve my chances of getting in?
Real answers and help only please! Thank you!
Answer:
Yes it's a good score for those colleges because that's an A, once you're above 1150 you'll be ok
The number of cell phones per 100 residents in countries in Europe is given in table #9. 3. 9 for the year 2010. The number of cell phones per 100 residents in countries of the Americas is given in table #9. 3. 10 also for the year 2010 ("Population reference bureau," 2013). Find the 98% confidence interval for the different in mean number of cell phones per 100 residents in Europe and the Americas
To find the 98% confidence interval for the difference in mean number of cell phones per 100 residents in Europe and the Americas, we would need the sample means, sample sizes, and the standard deviations for both regions. Without this information, it is not possible to calculate the 98% confidence interval.
What is a Confidence Interval?A confidence interval, in statistics, refers to the probability that a population parameter will fall between two set values.
Based on the fact that the necessary information is not provided, the general overview is given to help you calculate the confidence interval
Read more about confidence interval here:
https://brainly.com/question/15712887
#SPJ1
PLS HURRY If, after you gather more details, you find that your prediction about the text is inaccurate, what should you do?
Answer:
Change your prediction & review the details you have now & make a new prediction
Explanation:
cause i got it right.
what does the SAT reading test requires students to do?
Answer:
When you take the Reading Test, you'll read passages and interpret informational graphics. Then you'll use what you've read to answer questions. Some questions ask you to locate a piece of information or an idea stated directly. But you'll also need to understand what the author's words imply.
Answer: (B) reading passages and answer questions to show an ability to analyze documents
Explanation:
Pablo said that sports taught him to follow instructions, prepare for games, adjust to new situations, and the value of losing as well as winning
Answer:
also
it strengthen his physical state
it also build self confidence
help please i need to get this done
Answer: D
Explanation because there is no point in having to know other skills. that don't evolve your job.
Answer:
B
Explanation:
What is filling
your bucket
today and what's
draining it?
Answer:
me socializing through social media and me getting distracted from socializing
Explanation:
i either focus on one thing or another. its hard to focus on school when im talking to people : /
Why are you unique???
Answer:
I am unique because I am my own person and I have my own personality.
Explanation:
While Jenner's interest in the protective effects of cowpox began during his apprenticeship with George Harwicke, it was 1796 before he made the first step in the long process whereby smallpox, the scourge of mankind, would be totally eradicated. For many years, he had heard the tales that dairymaids were protected from smallpox naturally after having suffered from cowpox.
—"Edward Jenner and the History of
Smallpox and Vaccination,"
Stefan Riedel
Which statements support the claim that Jenner has been given credit for starting and spreading the practice of immunization?
Jenner became interested in the protective effects of cowpox during his apprenticeship.
Jenner’s mentor was George Harwicke.
Jenner made the first step to erase smallpox.
Smallpox is called the scourge of mankind.
Jenner heard stories of cowpox helping to save people from smallpox.
u know who I am.......................oeoeoooeoeooeeoeooeoe
Answer:
Yes
Explanation:
No
Answer:
Yea i'm you
Explanation:
Read this excerpt from "Fences."
I peek through the cactus fence
and watch the women rub oil
sweeter than honey into their arms and legs
while their children jump waves
or sip drinks from long straws,
coconut white, mango yellow.
What is one theme of the poem that the speaker’s perspective reveals?
There are hurtful divisions between rich and poor.
People often do not get to visit their hometown’s sites.
Children live in a fantasy world that adults cannot join.
The ocean is powerful, and one needs to be careful around it.
Answer:
B
Explanation: I took the test.
Answer:
The correct answer choice is A
Explanation:
just took the quiz on edg.
The ____ is a low-interest loan funded by the U.S. Department of Education
that eligible students may take out to help pay for college,
A. FAFSA
B. SMART Loan
C. Direct Stafford Loan
D. Pell Grant
The Direct Stafford Loan is a low-interest loan funded by the U.S. Department of Education that eligible students may take out to help pay for college. The correct option is C.
What is Direct Stafford Loan?The Direct Stafford Loan is a federal student loan funded by the United States Department of Education that is available to qualified students enrolled in an accredited institution of higher learning.
This loan, which has a low fixed interest rate and flexible repayment options, is intended to assist students in paying for college expenses such as tuition, fees, and books.
Students must complete the FAFSA (Free Application for Federal Student Aid) in order to be considered for federal student aid programs such as the Direct Stafford Loan.
The SMART Loan (Science, Mathematics, and Research for Transformation) is a scholarship-for-service program offered by the Department of Defense that covers full tuition and education-related expenses for students.
Thus, the correct option is C.
For more details regarding Direct Stafford Loan, visit:
https://brainly.com/question/4267405
#SPJ5
Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1
1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt
Part 2
1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)
Part 3
Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms
Part 4
Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.
Part 5
Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.
The appropriate verbs for the given sentences are given below:
Part 1
waswas lyingwouldfeelsPart 2
were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould bePart 3
hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshavePart 4
1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.Part 5
itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheirWhat is a Verb?This refers to the part of speech that shows action in a given sentence.
Hence, the words have been correctly selected above from the four different parts of the question.
Read more about verbs here:
https://brainly.com/question/1718605
#SPJ1
Which of the following is an issue of food quality rather than food safety?
a prep cook who uses the same cutting board for chicken and salad
a bad odor associated with food
a food handler who did not wash her hands before serving food
food that has been time/temperature abused
can someone pls help me with latin??
Answer:
where is the question ?
When you add hot water to cold water the cold water warms up because of
Okay this is like Science or Chemistery, probably Sience
Answer:
So say you have some cold water running, if you turn on the hot water than the hot water will start coming too. The energy of the hot water will start warming up the cold water.
Explanation:
I don't really know, just tossing reasonable stuff out here.
“I study to get good grades because my parents want to send me to the college of my choice.” This is an
Answer:
a what
Explanation:
it's good you get good grades going to college is interesting if you want to
There’s a picture by the way the drop-down boxes are all the same choices this is career exploration‘s
Answer:
1. Information Technology
2. Manufactoring
3. Law, Public Safety, and Security
Explanation:
Information Technology IT usually involves using technology to solve problems which fits Mel's job description.
Putting together car engines comes under manufactoring because it is a widely used product that needs to be widely manufactored.
Being a judge in a local court means that you are concerned with the public law and safety because you convict people who are in breach of the law.
Hope this helped!
L 8.1.2 Exam: Semester Exam
Which statement best summarizes the following portion of the Declaration of
Independence?
We hold these truths to be self-evident, that all men are
created equal, that they are endowed by their Creator with
certain unalienable Rights, that among these are Life,
Liberty and the pursuit of Happiness.. That to secure
these rights, Governments are instituted among Men,
deriving their just powers from the consent of the
governed, That whenever any Form of Government
becomes destructive of these ends, it is the Right of the
People to alter or to abolish it, and to institute new
Government, laying its foundation on such principles and
organizing its powers in such form, as to them shall seem
most likely to effect their Safety and Happiness.
-
O A. Governments tend to interfere with people's rights.
B. All human beings are equal and should have an equal share of the
land.
ty
O
C. People have certain rights and it is the role of government to
protect those rights.
The statement that best summarizes the following portion of the Declaration of Independence is "People have certain rights and it is the role of government to protect those rights." (Option C)
How is this so?The statement emphasizes that all individuals are inherently equal and possess unalienablerights such as life, liberty, and the pursuit of happiness.
It asserts that governments are established to safeguard these rights and derive their power from the consent of the governed.
If a government fails to upholdthese principles, the people have the right to change or replace it with a new government that prioritizes their safety and well-being.
Learn more about declaration of independence at:
https://brainly.com/question/472238
#SPJ1
why is Pluto called a ,"dwarf planet" ?
Answer:
Pluto is called a dwarf planet because it does not meet the three criteria set forth by the International Astronomical Union (IAU) for a full-sized planet.
These criteria are:
It must be in orbit around the Sun.It must be massive enough for its self-gravity to overcome rigid body forces so that it assumes a hydro-static equilibrium (nearly round) shape.It has cleared the neighborhood around its orbit.Pluto meets the first two criteria, but it does not meet the third. The Kuiper Belt is home to many other objects that are similar in size to Pluto, and these objects share Pluto's orbit. This means that Pluto has not cleared its neighborhood of other objects, as a planet is supposed to do.
As a result of this, Pluto was reclassified as a dwarf planet in 2006. There are now five dwarf planets in our solar system: Pluto, Ceres, Eris, Makemake, and Haumea.
Answer and Explanation:
Pluto is called a "dwarf planet" because it does not meet the criteria to be classified as a full-fledged planet. In 2006, the International Astronomical Union (IAU) redefined the definition of a planet, which led to Pluto being reclassified as a dwarf planet. Here are the main reasons why:
1. Size: While Pluto is larger than some moons in our solar system, it is much smaller than the eight traditional planets like Earth, Jupiter, and Saturn. Its size is comparable to other objects in the Kuiper Belt, a region beyond Neptune where many icy bodies reside.
2. Orbit: Unlike the eight planets that have relatively clear paths around the Sun, Pluto has a more elongated and inclined orbit. This means it has a more irregular path and crosses the orbit of Neptune at certain points. This is different from the regular, more circular orbits of the traditional planets.
3. Neighborhood: Pluto is part of a region called the Kuiper Belt, which consists of numerous icy bodies and small objects. This region is distinct from the inner solar system where the eight traditional planets reside. The presence of many similar-sized objects in its vicinity further influenced the decision to reclassify Pluto.
By considering these factors, the IAU determined that Pluto did not meet the criteria to be classified as a planet. Instead, it was designated as a dwarf planet, a new category that acknowledges its unique characteristics and its place in the Kuiper Belt.
It's important to note that this reclassification sparked some debate and controversy among astronomers and the public. However, the IAU's decision to classify Pluto as a dwarf planet is the current scientific consensus.
how do you think khanyi's relationship with her mother has been affected by the role that khanyi has to play
It may be inferred that when the reality program first aired, Khanyi and Khanz's relationship was rocky to say the least. Khanyi had left Khanz to straddle between boarding school and her mother's residence in an attempt to recapture her status.
When the show first aired, it seemed that Khanz knew Khanyi as well as a fan would—through television and social media posts. But it didn't take long for their relationship to grow.
What is an inference?Inferences are processes in thinking that move from premises to logical conclusions; the word infer is etymologically related to "carry forward." Theoretically, inference is typically separated into deduction and induction.
A person is considered to have drawn an inference when they reach a conclusion by combining one or two logical facts.
Learn more about inference:
brainly.com/question/25280941
#SPJ1
The photograph below shows a carved limestone head. The surface of this
limestone has changed over many years.
Which process made the surface of the limestone change over many years?
carving
polishing
melting
weathering
Name a substance in the air that made the surface of the limestone
change.
ASAP
Answer:
Weathering (I think)
Explanation:
don't know what else to add because you need a minimum of twenty words to answer
In exercise, simplify each algebraic expression. 3(4y − 5) − (7y 2)
Answer:
-2y-15
Explanation:
12y-15-14y
-2y-15
Walking logs can help you see where you have been and where you are going. A. True B. False