The correct order of the events that happened are:
The boys arrived at Cogston House.The boys celebrated their eleventh birthdays.Jack and Luca went to the park to play on the swing.Jack and Luca went to The Top End.What are order of events in a story?The sequence of events in a story is referred to as the story. Simply put, sequencing a story is determining the beginning, middle, and end of the story as a first step toward retelling the events in a logical order.
Luca was feeling happy as it was his birthday and he was playing in the park.
Therefore, the correct order is
The boys arrived at Cogston House.The boys celebrated their eleventh birthdays.Jack and Luca went to the park to play on the swing.Jack and Luca went to The Top End.To learn more about order of events, refer to the link:
https://brainly.com/question/29630288
#SPJ9
Andrew attends a school that is based on the teaching of religious leader. What kind of school does he attend?
Question 8 of 25
The exact same experiment was conducted 15 times. How many times
should the results have been similar for them to be valid?
A. 15
B. 9
C. 8
D. 6
To consider the results of the 15 experiments valid, they should be similar in at least 8 of the trials . So, option C is the right choice.
To determine the number of times the results should be similar for them to be considered valid, we need to establish a threshold based on the number of experiments conducted. In this case, the experiment was repeated 15 times.
To determine the minimum number of times the results should be similar for validity, we can calculate the majority. We divide the total number of trials by 2 and add 1. In this case, 15 divided by 2 equals 7.5, and adding 1 gives us 8.
Therefore, for the results to be considered valid, they should be similar in at least 8 out of the 15 trials. This threshold ensures that the majority of the experiments produced consistent results, indicating reliability and reproducibility.
Thus, The correct answer is option C.8
For more such question on experiments
https://brainly.com/question/26150306
#SPJ8
Fill in the blanks with appropriate verbs. Remember to observe the rules regarding the
sequence of tenses.
Part 1
1. They sold the house because it ……………….. old.
is
was
has been
2. I found out that he ………………………..
is lying
was lying
has lied
3. I never thought that I ……………………. see him again.
will
would
had
4. She replied that she ……………………. better.
feel
feels
felt
Part 2
1. I wish you _______ here with me today. (to be)
2. We missed the train since we _______ home late. (leave)
3. Priya says that she _______ the guy properly. (see – negative)
4. I wish my brother _______ what he was sacrificing to get what he wanted. (understand)
5. They did not know why Pranav _______ that way. (behave)
6. He _______ to go home only after he finishes all that has been assigned to him. (allow)
7. My parents acted as if they _______ anything about the accident. (know – negative)
8. Unless you _______ what you feel (express), nobody _______ what is really going on with you. (know)
9. The teacher taught us that the Sun _______ in the East. (rise)
10. Her mom thinks that it _______ a good idea. (to be)
Part 3
Subject-Verb Agreement Practice Exercises
1. Everyone (has/have) done his or her homework.
2. Each of the students (is/are) responsible for doing his or her work.
3. Either my father or my brothers (is/are) going to sell the car.
4. Neither my sisters nor my mother (is/are) going to sell the house.
5. The samples on the tray in the lab (need/needs) testing.
6. Mary and John usually (plays/play) together.
7. Both of the dogs (has/have) collars.
8. Neither the dogs nor the cat (is/are) very hungry.
9. Either the girls or the boy (walk/walks) in the evening.
10. Either the boy or the girls (walk/walks) in the evening.
11. At the end of the fall (comes/come) the hard tests.
12. The slaughter of animals for their fur (has/have) caused controversy.
13. The student, as well as his teacher, (was/were) going on the field trip.
14. The hard tests (comes/come) at the end of the fall.
15. Both of my roommates (has/have) decided to live in the dorms
Part 4
Parallelism Practice Answer Sheet
1. In the spring, summer, or in the winter, we will go to Germany.
2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.
3. The internet can be used to find word meanings, medical information, and locating hotels.
4. Tennis requires hand-eye coordination, flexibility, and to be able to concentrate. 5. The teacher has the responsibility of providing supplemental help and to review all test material with the students.
6. Veronica threw the rock at the window and the glass was broken.
Part 5
Making Pronouns and Antecedents Agree Directions: Circle the pronoun that correctly completes each sentence. Also, underline the antecedent(s) of the pronoun.
1) When the team scored a touchdown, the crowd threw (its, their) hats in the air. 2) Neither Carmen nor her sisters have bought a gift for (her, their) brother.
3) Scuba divers are taught that (you, they) should check (your, their) equipment. 4) Patrick and Warren will present (his, their) routine before the other gymnasts do.
5) Not one hiker would set out without (his or her, their) compass.
6) Sal and Marcus shop for clothes here because (you, they) can find good bargains.
7) Either Debbie or Melinda will bring (her, their) ice skates.
8) Anyone who wants a job should bring (his or her, their) application to me.
9) Arctic explorers discover that (you, they) cannot expose skin to the icy air.
10) I told everyone in the boys’ choir that (you, he) had to bring a boxed lunch.
11) Neither Carl nor Mark asked (his, their) parents to chaperone the dance.
12) The town council will be presenting (its, their) own proposal for the new park. 13) Fran always liked walking home because (you, she) saved money on bus fare. 14) If (you, they) should fall, experienced in-line skaters know that knee and elbow pads will reduce the risk of injury.
15) Neither Kate nor Anne has had (her, their) vacation pictures developed yet.
The appropriate verbs for the given sentences are given below:
Part 1
waswas lyingwouldfeelsPart 2
were hereleftdid not seeunderstoodbehavedwas alloweddid not knowexpress, would knowriseswould bePart 3
hasisisareneedsplayhavearewalkwalkcomeshaswerecomeshavePart 4
1. In the spring, summer, or in winter, we will go to Germany.2. Eric Foreman decorates the Christmas tree, picks up his grandma from the nursing home, and friends are invited over for dinner.3. The internet can be used to find word meanings, medical information, and locate hotels.4. Tennis requires hand-eye coordination, flexibility, and the ability to concentrate. 5. The teacher has the responsibility of providing supplemental help and reviewing all test material with the students.6. Veronica threw the rock at the window and the glass was broken.Part 5
itstheirthey, theirtheirhis or hertheyherhis or hertheyhetheiritsshetheytheirWhat is a Verb?This refers to the part of speech that shows action in a given sentence.
Hence, the words have been correctly selected above from the four different parts of the question.
Read more about verbs here:
https://brainly.com/question/1718605
#SPJ1
why is Pluto called a ,"dwarf planet" ?
Answer:
Pluto is called a dwarf planet because it does not meet the three criteria set forth by the International Astronomical Union (IAU) for a full-sized planet.
These criteria are:
It must be in orbit around the Sun.It must be massive enough for its self-gravity to overcome rigid body forces so that it assumes a hydro-static equilibrium (nearly round) shape.It has cleared the neighborhood around its orbit.Pluto meets the first two criteria, but it does not meet the third. The Kuiper Belt is home to many other objects that are similar in size to Pluto, and these objects share Pluto's orbit. This means that Pluto has not cleared its neighborhood of other objects, as a planet is supposed to do.
As a result of this, Pluto was reclassified as a dwarf planet in 2006. There are now five dwarf planets in our solar system: Pluto, Ceres, Eris, Makemake, and Haumea.
Answer and Explanation:
Pluto is called a "dwarf planet" because it does not meet the criteria to be classified as a full-fledged planet. In 2006, the International Astronomical Union (IAU) redefined the definition of a planet, which led to Pluto being reclassified as a dwarf planet. Here are the main reasons why:
1. Size: While Pluto is larger than some moons in our solar system, it is much smaller than the eight traditional planets like Earth, Jupiter, and Saturn. Its size is comparable to other objects in the Kuiper Belt, a region beyond Neptune where many icy bodies reside.
2. Orbit: Unlike the eight planets that have relatively clear paths around the Sun, Pluto has a more elongated and inclined orbit. This means it has a more irregular path and crosses the orbit of Neptune at certain points. This is different from the regular, more circular orbits of the traditional planets.
3. Neighborhood: Pluto is part of a region called the Kuiper Belt, which consists of numerous icy bodies and small objects. This region is distinct from the inner solar system where the eight traditional planets reside. The presence of many similar-sized objects in its vicinity further influenced the decision to reclassify Pluto.
By considering these factors, the IAU determined that Pluto did not meet the criteria to be classified as a planet. Instead, it was designated as a dwarf planet, a new category that acknowledges its unique characteristics and its place in the Kuiper Belt.
It's important to note that this reclassification sparked some debate and controversy among astronomers and the public. However, the IAU's decision to classify Pluto as a dwarf planet is the current scientific consensus.
At this hospital, 2% of patients are classified as Level 1, 7% are classified as Level 2, 30% are
classified as Level 3, 10% are classified as Level 5, and the remaining percentage of patients are
classified as Level 4.
At this hospital, 99% of Level 1 patients stay overnight, 90% of Level 2 patients stay overnight, 30%
of Level 3 patients stay overnight, 10% of Level 4 patients stay overnight, and 1% of Level 5 patients
stay overnight.
Kennedy (a nurse at this hospital) randomly selects a patient who is staying in the hospital
overnight. What is the probability that this patient was initially classified as Level 1? Round to the
three decimal places.
Hint
P(Level 1 GIVEN overnight) =
1Gilboy, N. , Tanabe, T. , Travers, D. , & Rosenau, A. M. -2011. Emergency severity index (ESI): A triage tool for
mergency department care Version 4. Implementation Handbook 2012 Edition Arena
Hi, the answer to that 0.02 or 2%. hope it helps.
Is the article Ukraine Helicopter Crash Worth Reading? Explain
Answer: If you are talking about the one that I think you are talking about then yes, it is worth reading because it gives you knowledge about the type of issues that are going on in different countries. It's also informative and you can learn different things about it.
Explanation:
5. What is the author’s main purpose in writing this article? Cite evidence from the text in your response. It's for a common lit. Here is the title for the article Scientist Clone Human Embryos to Make Stem Cells
Answer: The main purpose he has for writing this is that the cloaning of humans can be done but it is also very hard to do.
Explanation: But every previous attempt ended in failure or fraud, leading many scientists to wonder if the goal might be impossible to reach.
Vildl
JES !
Pido prestado dinero de mi madre cuando voy de compras.
O I lend
O lowe
O I borrow
O pay
Answer:
C- I borrow
Explanation:
I will give anybody 75 points if they answer this question?
How did Huck leaving civilization affect him?
Answeri do not know
Explanation:
Answer:
He believes that becoming civilized is a loss of freedom, because he doesn't want to be like everyone else.
Which scenario best describes a person who is likely to be vulnerable to trafficking because of drug or alcohol dependence?.
Guys, I am taking the SHSAT and I am not confident I don't think I am smart enough to pass. I study like crazy but nothing sticks in my mind and if I don't pass my parents will be disappointed. What do I do?
Answer:
Take time for yourself every so often, relax, treat yourself, be confident and don't over study. Studying to much can cause stress and you can become overwhelmed super quick, I tend to do it a lot. You don't need to have the perfect score, but don't just get by. Give it all you have and it will pay off, I promise. Don't ever think not making a perfect score on a test will cause your parents to become upset, trying your best will make them proud. You'll see it when you make that above average score! Everyone is intelligent no matter what; you're a smart and talented individual, don't ever forget that. Hopefully everything goes well and good luckk! :)
prayer. prayer works well trust in god.
if an interview ask questions at the end of an inte they are
Answer:
Explanation:
yes
I need the answer to this
1) The order in which the events occurred is:
The great Greek era of the theaterPageant wagons are first usedThe first trope appears in the massThe presentations are moved outside the churchThe church outlaws theaterTheater continues throughout the Roman eraWriters of the Medieval era begin to write non-religious playsSeries of scenes called cycles are presented.2) The Eye Witness account is as follows:
"I am attending a church service and just witnessed a trope being performed. The set is simple, with painted backdrops and minimal props. The actors wear basic robes, but their energetic performances bring the story to life. The singing is beautiful and adds to the overall religious atmosphere. I am in awe of the talent and devotion on display."
Note that the Greek era was a time of great artistic and cultural achievement, particularly in the realm of theater.
Playwrights such as Aeschylus, Sophocles, and Euripides created masterpieces that are still performed and studied today. The Greeks developed the conventions of tragedy and comedy and elevated theater to a high art form.
Learn more about the Greek Era:
https://brainly.com/question/2396307
#SPJ1
How does Wiesel feel about the power of memory? Highlight and label any rhetorical devices Wiesel uses to stress his point.
Passage: “Home, Despair, and Memory” By Elie Wiesel
Why is gum pink? I've always been wondering about this.
Answer: Bubble gum got its distinctive pink color because the original recipe Diemer worked on produced a dingy gray colored gum, so he added red dye (diluted to pink) as that was the only dye he had on hand at the time.
What is the role of sellers in a market economy?
A
They primarily create supply.
B
They primarily create demand,
С
They primarily provide regulations.
D
They primarily compete with buyers.
Answer:
B they primarily create demand
By artificial selection, certain traits have been selected to be passed on to the offspring in certain tomato plants. Which traits have been strongly influenced by genetics in these tomato plants?
Responses
Answer:
Fruit size and shape: Some tomato varieties have been bred to produce larger or smaller fruits with different shapes, such as round or oblong.Color: Tomato plants have been bred to produce fruits with different colors, such as red, yellow, orange, green, or even purple.Disease resistance: Tomato plants have been bred to resist certain diseases, such as verticillium or fusarium wilt, or pests such as the tomato hornworm.Flavor: Tomato plants have been bred to produce fruits with different flavors, such as sweet, tangy, or acidic.
offspring from the first cross
Which term refers to the medicine that causes the body to make antibodies against certain viruses?
immunity
cilia
antibiotics
vaccines
Answer:
It is C!
Explanation:
Hope this helped!
what is 1+1?
A. 3
B. 1
C. 4
D. 0
Answer:
What is 1 + 1?
A. 3
B. 1
C. 4
D. 0
None of the above.Explanation:
You're welcome.
What is a goal of the mission of the James Webb Space Telescope?
to find evidence of life on Mars
to study how solar flares of our sun affect Earth
to find evidence of events in the history of the universe
to study how Venus and Earth diverged as planets
(33 points)
Answer:
to find evidence of events in the history of the universe
Explanation:
A goal of the mission of the James Webb Space Telescope is to find evidence of events in the history of the universe.
The correct answer to the given question is option C.
The James Webb Space Telescope has several objectives and goals, with the primary aim of its mission being to identify the events that led to the formation of the universe.
In addition, it aims to collect data on various galaxies, stars, and planets that will help scientists determine the evolution of these entities.The primary objective of the James Webb Space Telescope is to identify the early universe's formation by collecting data on the stars, galaxies, and planets.
It is also aimed at gathering data on various celestial objects such as exoplanets and black holes.The James Webb Space Telescope aims to collect data that will allow astronomers to determine the events that led to the formation of the universe.
It will collect data on distant galaxies, stars, and planets to provide insights into the evolution of these entities. The telescope will have advanced capabilities such as infrared vision that will allow it to collect data on some of the universe's earliest structures.
Additionally, the James Webb Space Telescope aims to collect data on exoplanets, which could provide insights into how life in the universe developed. The telescope's ability to identify the atmospheric composition of exoplanets will be crucial in determining their habitability.
Ultimately, the telescope's primary goal is to contribute to the advancement of our understanding of the universe.
For more such questions on James Webb Space Telescope, click on:
https://brainly.com/question/8962979
#SPJ8
Currently, a particular species of unicellular organism inhabits the intestines of termites, where the unicellular organisms are protected from predators. Wood that is ingested by the termites is digested by the unicellular organisms, forming food for the termites. However, hundreds of thousands if not millions and millions of years ago, this relationship between unicellular organisms and termites did not exist. Given this information, 1) how would you best characterize this present-day relationship between unicellular organisms and termites and 2) what evolutionary phenomena best describes the process by which this relationship formed? select only one answer choice. Select the best answer choice
Where the conditions above with regard to unicellular organisms are given, the best answer choices would be
MutualismCoevolutionHow is this so?The present-day relationship between the unicellular organisms and termites can be characterized as mutualism. Mutualism refers to a symbiotic relationship where both species benefit from the association.
This relationship likely formed through coevolution, which is an evolutionary phenomenon where two or more species exert selective pressure on each other, leading to reciprocal adaptations.
Learn more about unicellular organism at:
https://brainly.com/question/24540805
#SPJ1
Full Question:
Although part of your question is missing, you might be referring to this full question:
Currently, a particular species of unicellular organism inhabits the intestines of termites, where the unicellular organisms are protected from predators. Wood that is ingested by the termites is digested by the unicellular organismo, forming food for the termites. However hundreds of thousands if not millions and millions of years ago, this relationship between unicellular organisms and termites did not exist. Given this information. 1) how would you best characterize this present-day relationship between unicelular organisms and termiten and 2) what evolutionary phonomena bost describes the process by which this relationship formed? Select only ONE answer choice. Select the BEST answer choice 1) mutualiam, 2) coevolution 1) parasitehost, looovolution 1) predatory convergent evolution 1) commensals 2) convergent evotion None of the above
The present-day relationship between unicellular organisms and termites is symbiotic. Symbiosis refers to a type of relationship between two or more different species, where each individual benefits from the interaction to varying degrees.
In this case, the unicellular organisms benefit from the protection provided by the termites, while the termites benefit from the food produced by the unicellular organisms.As for the second question, the evolutionary phenomena that best describes the process by which this relationship formed is coevolution.
Coevolution refers to the process by which two or more species influence each other's evolutionary trajectories through reciprocal selective pressures. As termites evolved to feed on wood, the unicellular organisms that lived in their guts evolved to digest that wood. In turn, the termites that hosted these unicellular organisms were able to extract more nutrition from the wood, which allowed them to thrive.
To know more about organisms visit:
https://brainly.com/question/13278945
#SPJ11
You throw a ball so that it hits the floor a few feet in front of you. Will it bounce back to you? Explain how the bounce is similar to the way light behave?
Answer:
ok
Explanation:
Smaller particles moved by the wind occurs through deflation.
Answer:
The answer would be true!
Explanation:
As smaller particles moved by the wind occurs through deflation.
hope it helps!
Assume a machine during its initial testing phase produces 10 widgets a day. After 10 days of testing (starting on day 11), it begins to ramp up, producing 1 more widget per day (11 widgets on day 11, 12 on day 12, etc). On day 50 it reaches full speed, where it continues to run until on day 101 it stops producing widgets. Write a program named lab4b_act3. Py that reads in a day (as a number) from the keyboard and reports the total number of widgets produced from the initial testing phase up to and including the day entered. For example, entering 3 would report 30 widgets
Python program named lab4b_act3.py needs to be created to read in a day (as a number) from the keyboard and report the total number of widgets produced from the initial testing phase up to and including the day entered.
Here is a possible Python code solution for this problem:```# Define the number of widgets produced during the initial testing phaseINITIAL_PRODUCTION = 10# Define the day on which the machine starts ramping upRAMP_UP_DAY = 11# Define the maximum number of widgets produced per dayFULL_SPEED_PRODUCTION = 50# Define the day on which the machine stops producing widgetsFINAL_DAY = 101# Read in the day number entered by the userday = int(input("Enter a day number: "))# Calculate the total number of widgets producedtotal_widgets = INITIAL_PRODUCTION * (RAMP_UP_DAY - 1)# Add the widgets produced during the ramp-up phasewhile RAMP_UP_DAY <= day and RAMP_UP_DAY <= FULL_SPEED_PRODUCTION: total_widgets += RAMP_UP_DAY RAMP_UP_DAY += 1# Add the widgets produced at full speedif day > FULL_SPEED_PRODUCTION: total_widgets += FULL_SPEED_PRODUCTION * (day - FULL_SPEED_PRODUCTION)# Output the total number of widgets producedprint("Total widgets produced: ", total_widgets)```In this solution, the code first defines the number of widgets produced during the initial testing phase as 10, the day on which the machine starts ramping up as 11, the maximum number of widgets produced per day as 50, and the day on which the machine stops producing widgets as 101.for more such question on Python
https://brainly.com/question/28675211
#SPJ11
13. What sorority is Kamala Harris a member of?
Answer:
Alpha Kappa Alpha
Explanation:
?
Based on the relationships in circles a and b, which relationship is true for circle c?.
It should be noted that when there are two secant segments that intersect each other in a circle, the product of a segment is equal to that of the other segment.
What is a segment?Your information is incomplete. Therefore, an overview of the relationship in a circle will be given. A segment is the set of points that has two end points.
There are two segments that can cross your circle which are the secant segment and the tangent segment.
Another relationship is that according to intersecting chord theorem, when two chords intersect inside a circle, the length of ab will be equal to cd.
Learn more about circles on:
https://brainly.com/question/22965557
Jonas taking the apple from the recreation area is an example of what type of figurative language?
This is a simplified coastal maine food web. Analyze the model. Select the phrases that accurately describe the flow of energy in this marine ecosystem. Select all that apply
The simplified coastal Maine food web shows the flow of energy in the marine ecosystem. The primary producers are the phytoplankton which are consumed bweb y the zooplankton. The zooplankton are then eaten by small fish like herring which are preyed upon by larger fish like cod and tuna.
This means that the energy flows from the bottom of the food web (phytoplankton) to the top (large fish) with each level consuming the level below it. The energy is transferred from one organism to another through feeding relationships. The energy that is consumed is used for growth, reproduction, and metabolism. Therefore, the flow of energy in this marine ecosystem is from the primary producers to the top predators. The simplified coastal Maine food web is a model that shows the interactions between different organisms in the marine ecosystem. The flow of energy in this ecosystem can be analyzed by looking at the feeding relationships between different organisms. The primary producers in this ecosystem are the phytoplankton which are consumed by the zooplankton. The zooplankton are then eaten by small fish like herring which are preyed upon by larger fish like cod and tuna.
The flow of energy in this ecosystem can be described as a pyramid with the primary producers at the base and the top predators at the apex. The energy flows from the bottom of the food web to the top with each level consuming the level below it. This means that the energy that is produced by the phytoplankton is consumed by the zooplankton which in turn are consumed by the small fish. The small fish are then eaten by the larger fish which are the top predators in the ecosystem.The energy that is consumed by each level of the food web is used for growth, reproduction, and metabolism. This energy is transferred from one organism to another through feeding relationships. Therefore, the flow of energy in this marine ecosystem is from the primary producers to the top predators. The energy that is consumed by the top predators is not available to any other organism in the ecosystem.
To know more about web visit:
https://brainly.com/question/12913877
#SPJ11
Read each question carefully. Choose the letter of the best answer and write it on your answer sheet.
Answer:
1. A
2. A
3.D
4.A
number 5 I am not so sure of the answer to it its either D or A